MSH2 anticorps

N° du produit ABIN630207

Cet anticorps anti-MSH2 est un anticorps Lapin Polyclonal détectant MSH2 dans WB. Adapté pour Humain, Rat, Chien et Poisson zèbre (Danio rerio).

Aperçu rapide pour MSH2 anticorps (ABIN630207)

Antigène: MSH2 (Mismatch Repair Protein 2 (MSH2))

Reactivité: Humain, Rat, Chien, Poisson zèbre (Danio rerio)

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MSH2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-MSH2 anticorps

Purification: Purified

Immunogène: MSH2 antibody was raised using a synthetic peptide corresponding to a region with amino acids KMSAVDGQRQVGVGYVDSIQRKLGLCEFPDNDQFSNLEALLIQIGPKECV

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MSH2 Blocking Peptide, (ABIN939948), is also available for use as a blocking control in assays to test for specificity of this MSH2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MSH2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MSH2

Antigène: MSH2 (Mismatch Repair Protein 2 (MSH2))

Autre désignation: MSH2

Sujet: MSH2 was identified as a locus frequently mutated in hereditary nonpolyposis colon cancer (HNPCC). When cloned, it was discovered to be a human homolog of the E. coli mismatch repair gene mutS, consistent with the characteristic alterations in microsatellite sequences (RER+ phenotype) found in HNPCC.

Poids moléculaire: 64 kDa (MW of target protein)

Pathways: Réparation de l'ADN, Production of Molecular Mediator of Immune Response